PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G0115
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 155aa    MW: 17163.2 Da    PI: 9.8901
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G0115genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-182267147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v+++G ++W++I+r++  gR++k+c++rw + 
      Gh_D06G0115 22 KGPWSAEEDRVLTRLVERYGARNWSLISRYIK-GRSGKSCRLRWCNQ 67
                     79*****************************9.***********985 PP

2Myb_DNA-binding49.41.1e-1576118347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ede ++ a+  +G++ W+tIa  ++ gRt++ +k++w++ 
      Gh_D06G0115  76 PFTKAEDETILAAHGVYGNR-WATIAMLLP-GRTDNAVKNHWNST 118
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.1311772IPR017930Myb domain
SuperFamilySSF466892.01E-3119115IPR009057Homeodomain-like
SMARTSM007171.2E-152170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-252375IPR009057Homeodomain-like
CDDcd001674.47E-142466No hitNo description
PfamPF139212.4E-172583No hitNo description
SMARTSM007176.3E-1473121IPR001005SANT/Myb domain
PROSITE profilePS5129420.16674123IPR017930Myb domain
CDDcd001671.92E-1076119No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2276122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MNGCSSSTSS SDTSSSESSR IKGPWSAEED RVLTRLVERY GARNWSLISR YIKGRSGKSC  60
RLRWCNQLSP DVEHRPFTKA EDETILAAHG VYGNRWATIA MLLPGRTDNA VKNHWNSTLK  120
RRAREQKKEQ KGSVVVDEEE VLTALTLAPP GSGGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-42211236108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450372.11e-111PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-55MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2R0I61e-111A0A0D2R0I6_G
STRINGVIT_18s0001g11170.t016e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145531122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-53myb domain protein 77